SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038010 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038010
Domain Number 1 Region: 92-160
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000244
Family LIM domain 0.016
Further Details:      
 
Domain Number 2 Region: 255-307
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000214
Family Homeodomain 0.0072
Further Details:      
 
Domain Number 3 Region: 60-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000198
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038010
Domain Number - Region: 156-185
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00235
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038010   Gene: ENSMMUG00000012259   Transcript: ENSMMUT00000044995
Sequence length 325
Comment pep:known chromosome:MMUL_1:1:172569371:172585695:-1 gene:ENSMMUG00000012259 transcript:ENSMMUT00000044995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPAPSRVSSPQGAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSP
EKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYY
RRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRA
HFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSG
CNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTG
LTKRVLQGEQILGHYSQTSRRLKIP
Download sequence
Identical sequences ENSMMUP00000038010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]