SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038045 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038045
Domain Number 1 Region: 335-419
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-17
Family Cadherin 0.0018
Further Details:      
 
Domain Number 2 Region: 106-195
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-16
Family Cadherin 0.00081
Further Details:      
 
Domain Number 3 Region: 222-334
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000357
Family Cadherin 0.003
Further Details:      
 
Domain Number 4 Region: 21-113
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000742
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 448-553
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000104
Family Cadherin 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038045
Domain Number - Region: 542-610
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00311
Family Rhodopsin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038045   Gene: ENSMMUG00000004479   Transcript: ENSMMUT00000045029
Sequence length 757
Comment pep:known_by_projection chromosome:MMUL_1:10:18232380:18308388:1 gene:ENSMMUG00000004479 transcript:ENSMMUT00000045029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAGRVKRGWVWNQFFVVEEYTGTEPLYVGKIHSDSDEGDGAIKYTISGEGAGTIFLIDEL
TGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQDINDSEPRFLHGPYIG
SVAELSPTGTSVMQVMASDADDPTYGSSARLVYSMLDGEHHFTVDPKTGGVIRTAVPDLD
REKKDESLLKVCCSHIRPRHRGLTPRETTVNINSKISMKPHHFNTKMYQFSIQESAPIGT
AVGRVKAEDSDVGENTDMTYHLKEESGSGGDVFKVTTDSDTQEAIIVVQKRLDFESQPVH
TVILEALNKFVDPRFADLGTFRDQAIVRVAVTDVDEPPEFRPPSRLLEVQEDAQVGSLVG
VVTARDPDAANRPVRYAIDRESDLDQIFDIDADTGAIVTGKGLDRETAGWHNITVLAMEA
VQLGRNERESGEGYSFITNMSVKHKSPYFLFSFQFQIVQSNPPSIIQKKVEHVSNEHDPA
RMSVYSFQLVPEAPSNPHFSLLDIQGTDNTAAVHTQHVGFNRQEQDVFFLPILVVDSGPP
TLSSTGTLTIRICGCDSSGTIQSCNTTAFVMAASLSPGALIALLVCVLILVVLVLLILTL
RRHHKSHLSSDEDEDMRDNVIKYNDEGGGEQDTEAYDMSALRSLYDFGESPPQAHLPSER
HSLPQGPPSPEPDFSVFRDFISRKVALADGDLSVPPYDAFQTYAFEGADSPAGSLSSLHS
GSSGSEQDFAYLSSWGPRFRPLAALYAGHRGDDEAQA
Download sequence
Identical sequences ENSMMUP00000038045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]