SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038085 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038085
Domain Number 1 Region: 57-245
Classification Level Classification E-value
Superfamily Kelch motif 7.32e-54
Family Kelch motif 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038085   Gene: ENSMMUG00000017849   Transcript: ENSMMUT00000045068
Sequence length 248
Comment pep:known chromosome:MMUL_1:1:167580589:167608756:1 gene:ENSMMUG00000017849 transcript:ENSMMUT00000045068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTPRYITDVIDAEPFIRCSLQCRDLVDEAKKFHLRPELRSQMQGPRTRARLGANEVL
LVVGGFGSQQSPIDVVEKYDPKTQEWSFLPSITRKRRYVASVSLHDRIYVIGGYDGRSRL
SSVECLDYTADEDGVWYSVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNI
DQWSMLGDMQTAREGAGLVVASGVIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKR
SDMMVIPC
Download sequence
Identical sequences ENSMMUP00000038085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]