SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038111 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000038111
Domain Number - Region: 75-141
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0233
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038111   Gene: ENSMMUG00000031371   Transcript: ENSMMUT00000045094
Sequence length 171
Comment pep:novel chromosome:MMUL_1:1:166618251:166620288:1 gene:ENSMMUG00000031371 transcript:ENSMMUT00000045094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHNIFTESEIKAPPPSLNDCIGMVDGRAESTDKKISRLDTELVKCKDQIKMRGGPAKNTV
TQKALRVLKQKRMYEQQQENRTQQSFNTEQVNYTIQSLKDTKTTADAMKLGAGEMKAYND
QIENLQDQVVDMMEDANEIQEALSRSYGGPEFNEDDLEAELDTHWVMSLWL
Download sequence
Identical sequences ENSMMUP00000038111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]