SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038135 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038135
Domain Number 1 Region: 173-210
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000000000283
Family Ran binding protein zinc finger-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038135   Gene: ENSMMUG00000011236   Transcript: ENSMMUT00000045116
Sequence length 210
Comment pep:known_by_projection chromosome:MMUL_1:1:165877546:165889016:-1 gene:ENSMMUG00000011236 transcript:ENSMMUT00000045116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNFVVDLRLYTDSLFLTVDFGLCVEESSTSRKRTTEDDIPTLPTSEHKCRNSREDGDLI
ENLTQDETSRLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQVNFTFEGECFF
FSFERSVSEQLGVGIKVEAGDTEQTSEEVGKVSDKKVIEMGKNDDLEDSKSLSDDTDVEV
TSEDEWQCTECKKFNSPSKRYCFRCWALRK
Download sequence
Identical sequences ENSMMUP00000038135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]