SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038236 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038236
Domain Number 1 Region: 351-410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000153
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 2 Region: 292-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000795
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 491-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 4 Region: 419-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038236
Domain Number - Region: 97-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000145
Family APC10-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038236   Gene: ENSMMUG00000031416   Transcript: ENSMMUT00000045217
Sequence length 534
Comment pep:novel chromosome:MMUL_1:10:2170864:2201549:1 gene:ENSMMUG00000031416 transcript:ENSMMUT00000045217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAAAAPPRHHPLGASLEADLALEPKLVGLALLGTARAREEAGGGFSLHPPYFNLAEGARI
AASATCGEAEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAANSNRAHPASNAIDGTERWW
QSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSMDFGRTYQPWQFF
ASSKRDCLERFGPQTLERITRDDAAICTTEYSRIVPLENPQIVVSLVNGRPGAMNFSYSP
LLREFTKATNVRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRCVCHGHADA
CDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQPWKPATANSANECQSCNCHGHATDC
YYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPDHPLDSPHVCCR
CNCESNFTDGTCEDLTGRCYCRPNFSGERCDVCAEGFTGFPSCYREHLPATPSSSNDTRE
QVLPAGQIVMCGCSPAGTLPEGCDEAGRCPCQPGFAGPHCDQCHPGYHGFPNCQ
Download sequence
Identical sequences ENSMMUP00000038236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]