SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038273 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038273
Domain Number 1 Region: 8-177
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.15e-72
Family p53 DNA-binding domain-like 0.000000787
Further Details:      
 
Domain Number 2 Region: 365-430
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.86e-20
Family SAM (sterile alpha motif) domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 213-253
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000301
Family p53 tetramerization domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038273   Gene: ENSMMUG00000016466   Transcript: ENSMMUT00000045251
Sequence length 501
Comment pep:known chromosome:MMUL_1:2:182109937:182213946:1 gene:ENSMMUG00000016466 transcript:ENSMMUT00000045251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYLENNAQTQFSEYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTE
VVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEF
TTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSI
RKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKE
SLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSQSSYGNSSPPLNKMNSMNKLPSVS
QLINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTP
PPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWK
GILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWN
DFNFDMDARRNKQQRIKEEGE
Download sequence
Identical sequences A0A2I3GX41 A0A2I3M2V8 A0A2J8WI16 A0A2K5MIE5 A0A2K5VCB4 A0A2K5XAR7 A0A2K6BU80 A0A2K6KGD4 A0A2K6NHK0 F7FN69
ENSMMUP00000038273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]