SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038274 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038274
Domain Number 1 Region: 99-271
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.28e-73
Family p53 DNA-binding domain-like 0.00000151
Further Details:      
 
Domain Number 2 Region: 459-524
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.4e-20
Family SAM (sterile alpha motif) domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 307-347
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000379
Family p53 tetramerization domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038274   Gene: ENSMMUG00000016466   Transcript: ENSMMUT00000045252
Sequence length 595
Comment pep:known chromosome:MMUL_1:2:181952916:182213946:1 gene:ENSMMUG00000016466 transcript:ENSMMUT00000045252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD
FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWYSTELKKLYCQI
AKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLI
RVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIV
TLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSTKNGDGTKRPFRQNTHGI
QMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQH
LLQKQTSIQSQSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMGANIPM
MGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYF
TTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSAST
VSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE
Download sequence
Identical sequences A0A2K5XAR2
ENSMMUP00000038274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]