SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038430 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038430
Domain Number 1 Region: 7-75
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.39e-24
Family PARP-type zinc finger 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038430   Gene: ENSMMUG00000021820   Transcript: ENSMMUT00000045402
Sequence length 76
Comment pep:known_by_projection chromosome:MMUL_1:1:143962684:143968775:1 gene:ENSMMUG00000021820 transcript:ENSMMUT00000045402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSE
Download sequence
Identical sequences ENSMMUP00000038430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]