SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038508 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038508
Domain Number 1 Region: 91-230
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 3.93e-41
Family Nucleoside diphosphate kinase, NDK 0.00033
Further Details:      
 
Domain Number 2 Region: 1-64
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000385
Family Thioltransferase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038508   Gene: ENSMMUG00000007755   Transcript: ENSMMUT00000045478
Sequence length 245
Comment pep:known_by_projection chromosome:MMUL_1:2:149501995:149518709:1 gene:ENSMMUG00000007755 transcript:ENSMMUT00000045478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCEPTFLFYA
IKDEALSDEDECVSHGKNNGEDEDMVSSDRTCTLAIIKPDAVAHGKTDEIIMKIQEAGFE
ILTNEDRTMTEAEMRLFYQHRAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTSWRTV
MGPCDPNVARREQPESLRAQYGTEMPFNAVHGSQDREDADRELALLFPSLKFSDKDTEAP
QGKSS
Download sequence
Identical sequences ENSMMUP00000038508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]