SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038526 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038526
Domain Number 1 Region: 69-246
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-50
Family Nuclear receptor ligand-binding domain 0.0000000749
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000805
Family Nuclear receptor 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038526   Gene: ENSMMUG00000018128   Transcript: ENSMMUT00000045493
Sequence length 258
Comment pep:novel chromosome:MMUL_1:1:139840139:139846385:-1 gene:ENSMMUG00000018128 transcript:ENSMMUT00000045493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRTVSKSIGPTCPFAGSCEVSKIQRRHCPACRLQKCLDAGMRKDMILSAEALALRRAKQA
QRRAQQTPMQLRPPAHLFIHHQPLPTLAPVLPLVTHFADVNTFMVQQVIKFTKDLPVFRS
LPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDAARVGFQVEFLELLFH
FHGTLRKLQLQEPEYVLLAAMALFSPAPYLTDRPGVTQRHEIDQLQEEMALTLQSYIKGQ
QQRPRDRSPGTPWIHWSG
Download sequence
Identical sequences ENSMMUP00000038526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]