SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038549 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038549
Domain Number 1 Region: 78-187
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.35e-22
Family L-aminoacid/polyamine oxidase 0.0057
Further Details:      
 
Domain Number 2 Region: 2-92,205-237
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.23e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038549   Gene: ENSMMUG00000022630   Transcript: ENSMMUT00000045516
Sequence length 243
Comment pep:known_by_projection chromosome:MMUL_1:1:139775309:139780034:1 gene:ENSMMUG00000022630 transcript:ENSMMUT00000045516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPQALETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSEL
LPAEAAPLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGILGIVYDSVAFP
EQDGSPPGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKELPSHCLVHL
HKNCIPQYTLGHWQKLESARQFLAAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTE
PNG
Download sequence
Identical sequences ENSMMUP00000038549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]