SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038754 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038754
Domain Number 1 Region: 124-355
Classification Level Classification E-value
Superfamily Kelch motif 5.23e-36
Family Kelch motif 0.017
Further Details:      
 
Domain Number 2 Region: 9-198
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 2.88e-25
Family Galactose oxidase, central domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038754
Domain Number - Region: 355-392
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00101
Family Fibronectin type III 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038754   Gene: ENSMMUG00000022571   Transcript: ENSMMUT00000045710
Sequence length 412
Comment pep:known chromosome:MMUL_1:11:105182492:105221717:1 gene:ENSMMUG00000022571 transcript:ENSMMUT00000045710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTATNQWF
LPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPPS
GLPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIP
VTKGVVPSPRESHTAVIYCKKDSGGPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGT
VPLPRSLHTASVIGNKMYIFGGWVPHKGENTETSPHDCEWRCTSSFSYLNLDTTEWTTLV
SDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAP
SQVQLIKATTNSFHVKWDEVSTVEGYLLQLSTDLPYQAASSDSSAAPNMQDQ
Download sequence
Identical sequences ENSMMUP00000038754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]