SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038872 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038872
Domain Number 1 Region: 687-902
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-104
Family Thrombospondin C-terminal domain 0.0000000869
Further Details:      
 
Domain Number 2 Region: 560-685
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.57e-34
Family TSP type-3 repeat 0.00000396
Further Details:      
 
Domain Number 3 Region: 479-562
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.18e-19
Family TSP type-3 repeat 0.0000667
Further Details:      
 
Domain Number 4 Region: 225-270
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000103
Family Assembly domain of cartilage oligomeric matrix protein 0.002
Further Details:      
 
Domain Number 5 Region: 53-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000127
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 6 Region: 316-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000168
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038872
Domain Number - Region: 363-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000297
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 275-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0617
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038872   Gene: ENSMMUG00000003902   Transcript: ENSMMUT00000045827
Sequence length 919
Comment pep:known chromosome:MMUL_1:1:133744987:133757833:-1 gene:ENSMMUG00000003902 transcript:ENSMMUT00000045827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQELRGALALLLLCSFASASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECVHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS
PAHSPCHVHAHCLFERNGAVSCQDNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVED
NCRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDN
CPKVPNPLQTDRDEDGVGDACDSCPEMSNPTQTDVDSDLVGDVCDTNEDSDGDGHQDTKD
NCPQLPNSSQLDSDNDGLGDECDGDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGD
VCEDDFDNDAVVDPLDVCPESAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQ
TMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYW
QATPFRAVAQPGLQLKAVTSVSGPGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSY
RWQLLHRPQVGYIRVKLYEGPQLVADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCN
DTVPEDFEPFRRQLLQGRV
Download sequence
Identical sequences ENSMMUP00000038872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]