SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038901 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038901
Domain Number 1 Region: 1-190
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.47e-47
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038901   Gene: ENSMMUG00000031631   Transcript: ENSMMUT00000045861
Sequence length 191
Comment pep:known_by_projection chromosome:MMUL_1:15:98638948:98645189:1 gene:ENSMMUG00000031631 transcript:ENSMMUT00000045861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSVFYPACRISERYDIKGCEVSRWVDPAPEGSPIVLVLKDLNFQGKTIKLGPQRNWFLR
QMELDTTFLRELNVLDYSLLMAFQCLHEDERGLGSSLIFRTARSVQGAQSPEESGVQNRR
LLPDAPNALHILDGPEQRYFLGVVDLATVYGLRKRLEHLWKTLRYPGRTFSTVSPARYAR
RLCQWVEEHTE
Download sequence
Identical sequences ENSMMUP00000038901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]