SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038909 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038909
Domain Number 1 Region: 215-290
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000174
Family Intermediate filament protein, coiled coil region 0.005
Further Details:      
 
Domain Number 2 Region: 17-51
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000241
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038909
Domain Number - Region: 122-219
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.00471
Family Fibrinogen coiled-coil and central regions 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038909   Gene: ENSMMUG00000026843   Transcript: ENSMMUT00000036544
Sequence length 290
Comment pep:novel chromosome:MMUL_1:11:96059640:96060539:1 gene:ENSMMUG00000026843 transcript:ENSMMUT00000036544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGGYSGILAWSDGLLAGNEKLTMQNLNDRLASYLDKVHALEATNSKLEVKQKQGPRPSCN
YSHYCRTIEDLQDKILGAIIENSRIVLQIDNTHLAADDVRTKYVLDEVTLARTDLKAQIK
GLKEELAYLKKNHEEEINVLRGQVGDQVNVESDLPRSRVTGKANMRSWPSNQKDAEAWFT
SWTEELNQEVTGHTEQLQVSRSEVTDLRCTLQGLELQLQLSMKTPLESTLAETEVCSGAQ
LAQIQALISSIKAQLGDVQAEGEWQNQEYQNQEYQQLLEQITTYRSLLEG
Download sequence
Identical sequences 9544.ENSMMUP00000038909 ENSMMUP00000038909 ENSMMUP00000038909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]