SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038953 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038953
Domain Number 1 Region: 379-457
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.91e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000813
Further Details:      
 
Domain Number 2 Region: 142-221
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 3 Region: 38-110
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000672
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038953
Domain Number - Region: 289-294
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038953   Gene: ENSMMUG00000018871   Transcript: ENSMMUT00000045912
Sequence length 463
Comment pep:known chromosome:MMUL_1:15:92700915:92712536:-1 gene:ENSMMUG00000018871 transcript:ENSMMUT00000045912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKL
FQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFT
MMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMA
YEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF
Download sequence
Identical sequences A0A1S3A2Q9 A0A1S3GCU5 A0A287DFJ3 A0A2J8WPC1 A0A2K5TNX2 A0A2K6TQI3 F6Q4Q1 H9FTS7 K7DP62 K9IL20 M3WLH7 M3XSI8 P61978 P61979 P61980 U3CKT0
ENSECAP00000022686 ENSMMUP00000038953 ENSMPUP00000002038 gi|14165435|ref|NP_112552.1| 9796.ENSECAP00000022686 ENSP00000317788 ENSP00000353552 ENSECAP00000022686 ENSP00000317788 ENSP00000353552 ENSP00000365440 APC162 ENSMPUP00000002038 ENSMUSP00000039269 NP_001305117.1.87134 NP_001305117.1.92137 NP_079555.1.92730 NP_112552.1.87134 NP_112552.1.92137 NP_476482.1.100692 NP_476482.1.4139 XP_001155028.1.37143 XP_001155252.1.37143 XP_001368466.1.35504 XP_002742833.1.60252 XP_003267512.1.23891 XP_003267514.1.23891 XP_003364038.1.31192 XP_003809222.1.60992 XP_003809224.1.60992 XP_003941170.1.74449 XP_004048235.1.27298 XP_004048236.1.27298 XP_004381362.1.4749 XP_004407653.1.74151 XP_004407654.1.74151 XP_004407655.1.74151 XP_004677587.1.23501 XP_004677588.1.23501 XP_004716021.1.18182 XP_004716022.1.18182 XP_004774147.1.14098 XP_005340978.1.77405 XP_005582096.1.63531 XP_006100071.1.53796 XP_006253616.1.100692 XP_006744256.1.47382 XP_006835024.1.41390 XP_006916150.1.64745 XP_007087633.1.5354 XP_007528446.1.11023 XP_007937118.1.48129 XP_008140252.1.99482 XP_008539331.1.77740 XP_008694028.1.72690 XP_008847631.1.79516 XP_010382318.1.97406 XP_010382319.1.97406 XP_010631229.1.5607 XP_011286565.1.62641 XP_011370358.1.92234 XP_011370359.1.92234 XP_011769366.1.29376 XP_011769367.1.29376 XP_011809376.1.43180 XP_011809377.1.43180 XP_011838133.1.47321 XP_011838134.1.47321 XP_011912243.1.92194 XP_012327551.1.9421 XP_012374539.1.11602 XP_012398531.1.9362 XP_012495488.1.63892 XP_012495489.1.63892 XP_012635268.2.48125 XP_012669164.1.62490 XP_012886525.1.60039 XP_014684001.1.49734 XP_014931758.1.86478 XP_014973462.1.72884 XP_014973463.1.72884 XP_015291961.1.63531 XP_015361550.1.40921 XP_015448122.1.64745 XP_015985866.1.101085 XP_015985867.1.101085 XP_016078459.1.3490 XP_016078461.1.3490 XP_016870157.1.92137 XP_017170884.1.92730 XP_017535253.1.32401 XP_019279084.1.44245 XP_019484920.1.44202 XP_019484921.1.44202 XP_019484922.1.44202 XP_019605698.1.88060 XP_019650539.1.58354 XP_020029290.1.5219 XP_021071428.1.100879 XP_021509961.1.76796 XP_021533631.1.83697 XP_021533632.1.83697 XP_021576283.1.77405 ENSRNOP00000025915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]