SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039086 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039086
Domain Number 1 Region: 26-397
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.18e-124
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000452
Further Details:      
 
Domain Number 2 Region: 496-640
Classification Level Classification E-value
Superfamily vWA-like 8.71e-29
Family Integrin A (or I) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039086   Gene: ENSMMUG00000005228   Transcript: ENSMMUT00000046046
Sequence length 863
Comment pep:known chromosome:MMUL_1:1:129655098:129695442:1 gene:ENSMMUG00000005228 transcript:ENSMMUT00000046046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPYASGMPIKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQD
FYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIE
LCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCV
QAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPD
GLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRR
PAPQKALYSTAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFV
KKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRR
VGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPS
FSPIVGETLQMLTTSVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITL
ANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVG
SPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVP
PGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEE
ARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMS
LQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLKNLPGVDPNNEAIRN
AMGSLASQATKDGKKDKKEEDKK
Download sequence
Identical sequences ENSMMUP00000039086 ENSMMUP00000039086 9544.ENSMMUP00000039086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]