SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039088 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039088
Domain Number 1 Region: 78-449
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.92e-125
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039088   Gene: ENSMMUG00000005228   Transcript: ENSMMUT00000030407
Sequence length 562
Comment pep:known chromosome:MMUL_1:1:129627557:129677192:1 gene:ENSMMUG00000005228 transcript:ENSMMUT00000030407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASASSGPSSSVGFSSFDPAVPSCTSSSAASGIKRPVAPEVLEAKQDSYISLVPYASGMP
IKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIF
FPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASG
SLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIR
IVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADM
YNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALY
STAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWK
ALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRVGSSGNSC
ITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPIVGET
LQMLTTSTTLEKLEVAESEFTH
Download sequence
Identical sequences A0A2K5M2G2 A0A2K5UW24
XP_005541971.1.63531 XP_007975430.1.81039 XP_011924959.1.92194 XP_015006325.1.72884 ENSMMUP00000039088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]