SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039120 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039120
Domain Number 1 Region: 3-243
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.99e-86
Family Eukaryotic proteases 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039120   Gene: ENSMMUG00000014739   Transcript: ENSMMUT00000046079
Sequence length 271
Comment pep:known_by_projection chromosome:MMUL_1:2:89766318:89768840:1 gene:ENSMMUG00000014739 transcript:ENSMMUT00000046079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGHRVSRIIGGLPALNRKWPWQVSLQTEDKHLCGASLIDRRWVLTAAHCVFSDLEYKVKL
GDTNLNAGSENTLVIPVKDIIFPSNFDFASLTNDIALALLAYSVNYSSHIQPVCLPKELF
EVETGTECWVTGWGRVSERVSGSGPFVLREAKLNILRHEQCRETIKKKSAAKSKMVTRGT
VCGYNDQGKDSCQGDSGGPLVCELNGTWFQVGIVSWGVGCGRKGYPGVYTEVSFYKKWII
DRLRQASCLNSADSLILVLCLMMPLGILVAP
Download sequence
Identical sequences ENSMMUP00000039120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]