SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039123 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039123
Domain Number 1 Region: 103-195
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.14e-25
Family Hormone receptor domain 0.00083
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039123
Domain Number - Region: 150-313
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000659
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039123   Gene: ENSMMUG00000014742   Transcript: ENSMMUT00000046082
Sequence length 333
Comment pep:known_by_projection chromosome:MMUL_1:2:89635916:89656522:-1 gene:ENSMMUG00000014742 transcript:ENSMMUT00000046082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTARIAPGLALLLCCPVLSSAYALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPA
SIMESDKGWTSTSTSGKPRKDKPSGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPL
GAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETRE
REVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRALSIFVK
DAVLYSGATLDEAERLTEEELRAIAQAPLPPATAAAGYAGCRVAVTFFLYFLATNYYWIL
VEGLYLHSLIFMAFFSEKKYLWGFTVFGWGAGT
Download sequence
Identical sequences ENSMMUP00000039123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]