SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039197 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039197
Domain Number 1 Region: 21-99
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000198
Family I set domains 0.0011
Further Details:      
 
Domain Number 2 Region: 103-187
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000859
Family I set domains 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039197   Gene: ENSMMUG00000004362   Transcript: ENSMMUT00000046153
Sequence length 278
Comment pep:known_by_projection chromosome:MMUL_1:1:128156243:128165114:1 gene:ENSMMUG00000004362 transcript:ENSMMUT00000046153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWFLTALLLWVPVDGQVDTTKAVITLQPLWVSVFQEETVTLQCEVPRLPGSSSTQWFLNG
TATQTSTPSYRITSASAKDSGEYRCQRGPSGRSDPIQLEIHRDWLLLQVSSRVFTEGEPL
ALRCHAWKDKLVYNVLYYQNGKAFKFFYRNSQLTILKTNISHNGAYHCSGMGKHRYTSAG
VSVTVKGLQLPTPVWLHVLFYLVVGIMFLVNTVLWVTIRKELKRKKKWNLEISLDSAHEK
KVTSSLQEDRHLEEELKSQEQKEQLQEGVHRKEPEEAK
Download sequence
Identical sequences ENSMMUP00000039197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]