SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039222 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039222
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.81e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039222   Gene: ENSMMUG00000000476   Transcript: ENSMMUT00000046178
Sequence length 179
Comment pep:known_by_projection chromosome:MMUL_1:1:126596011:126601999:-1 gene:ENSMMUG00000000476 transcript:ENSMMUT00000046178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQTTVCSVKKQPDFSTSGQWEVVTESEGKKEMNVFDGVMVCTGHHTDAHLPLESFPGIEK
FKGQYFHSRDYKNPEGFTGKRVIIIGIGNSGGDLAVEISHTAKQVFLSTRRGAWILNRVG
NYGYPFDVLFSSRLTHFMWKICGQSLANKYLETKINQRFDHEMFGLKPKHSTKDGVLTE
Download sequence
Identical sequences ENSMMUP00000039222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]