SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039229 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039229
Domain Number 1 Region: 21-71
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.0000000000141
Family Inositol polyphosphate kinase (IPK) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039229   Gene: ENSMMUG00000014730   Transcript: ENSMMUT00000046185
Sequence length 79
Comment pep:known chromosome:MMUL_1:2:87761939:87779006:1 gene:ENSMMUG00000014730 transcript:ENSMMUT00000046185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMR
KFTPQYKGKSQLLEGLPHW
Download sequence
Identical sequences ENSMMUP00000039229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]