SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039336 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039336
Domain Number 1 Region: 7-332
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.68e-117
Family Bee venom hyaluronidase 0.0000278
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039336
Domain Number - Region: 373-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0259
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039336   Gene: ENSMMUG00000020121   Transcript: ENSMMUT00000046294
Sequence length 401
Comment pep:known chromosome:MMUL_1:2:86115962:86125896:1 gene:ENSMMUG00000020121 transcript:ENSMMUT00000046294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLLPNRPFATVWNANTQWCLERHSVDVDVSIFDVVANPGQTFRGPDMTIFYSSQLGTYPY
YTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTK
DIYRQRSRALAASWAWAQQVFPDLDPQEQLYKACTGFEQAARALMEDTLRMGQALRPHGL
WGFYRYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHH
QAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDDLVQTIGVSAALGAAGV
VLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQRCHGHGRCARRDPEQME
AFLHLWPDGSLGDWKSFSCHCYCGWAGPTCQEPRLGPKEAI
Download sequence
Identical sequences ENSMMUP00000039336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]