SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039342 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039342
Domain Number 1 Region: 35-357
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.37e-123
Family Bee venom hyaluronidase 0.0000107
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039342
Domain Number - Region: 423-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00165
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039342   Gene: ENSMMUG00000006994   Transcript: ENSMMUT00000046300
Sequence length 473
Comment pep:known chromosome:MMUL_1:2:86092953:86097930:1 gene:ENSMMUG00000006994 transcript:ENSMMUT00000046300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAGPGPAVTLALVLAVAWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAF
DVQASPNEGFVNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHY
IRTQESEGLAVIDWEDWRPVWVRNWQDKDVYRRSSRQLVASRHPDWPPDRIVKQAQYEFE
FAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQLAW
LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR
RLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRLLVPYVVNVSW
ATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPSHTPGEPQLRPVGELSWADLDH
LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAAFHLTSLLALAALAFTWTL
Download sequence
Identical sequences A0A2K6CKP7 F7H9X1 G7NXS7
NP_001247453.1.72884 XP_011737742.1.29376 XP_011737743.1.29376 XP_011737744.1.29376 XP_011737745.1.29376 XP_014986269.1.72884 XP_014986270.1.72884 XP_014986271.1.72884 ENSMMUP00000009175 9544.ENSMMUP00000039342 ENSMMUP00000009175 ENSMMUP00000039339 ENSMMUP00000039342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]