SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039468 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000039468
Domain Number - Region: 41-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.00146
Family Fibronectin type I module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039468   Gene: ENSMMUG00000031859   Transcript: ENSMMUT00000046429
Sequence length 139
Comment pep:known chromosome:MMUL_1:15:41766927:41768210:1 gene:ENSMMUG00000031859 transcript:ENSMMUT00000046429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRMLWAGQAKGILGGWGIVCLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWL
RKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPD
PEWGSANTPVPGAPAPHSS
Download sequence
Identical sequences A0A0D9RDX2 A0A2K5MUS3 A0A2K5ZKC7 A0A2K6CP12 F7HL15 G7PRZ5
ENSMMUP00000039468 NP_001180699.1.72884 XP_005581408.1.63531 XP_007966970.1.81039 XP_011746502.1.29376 XP_011835524.1.47321 XP_011942477.1.92194 ENSMMUP00000039468 9544.ENSMMUP00000039468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]