SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039535 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039535
Domain Number 1 Region: 76-165
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.81e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 220-290
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.34e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000343
Further Details:      
 
Domain Number 3 Region: 4-64
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.64e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039535   Gene: ENSMMUG00000006608   Transcript: ENSMMUT00000046497
Sequence length 325
Comment pep:known chromosome:MMUL_1:11:50530427:50554007:1 gene:ENSMMUG00000006608 transcript:ENSMMUT00000046497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKL
EEIIXSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLP
NSTERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPYRPKPSSSPVIFAGGQAY
TIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSAGLDASAQTTSHELTIPNDLIGCI
IGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINVSCMPWLFSA
RIPLNEAYQVLEYLSLKALNWIPGP
Download sequence
Identical sequences ENSMMUP00000039535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]