SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039562 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039562
Domain Number 1 Region: 364-477
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-20
Family Cadherin 0.0029
Further Details:      
 
Domain Number 2 Region: 37-167
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000115
Family Cadherin 0.0023
Further Details:      
 
Domain Number 3 Region: 250-360
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000615
Family Cadherin 0.0089
Further Details:      
 
Domain Number 4 Region: 471-587
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000657
Family Cadherin 0.0072
Further Details:      
 
Domain Number 5 Region: 144-237
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000714
Family Cadherin 0.02
Further Details:      
 
Domain Number 6 Region: 8-45
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000393
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039562   Gene: ENSMMUG00000031903   Transcript: ENSMMUT00000046529
Sequence length 671
Comment pep:novel chromosome:MMUL_1:2:72603646:72649017:1 gene:ENSMMUG00000031903 transcript:ENSMMUT00000046529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFTTGVPKLDFEMVTLYSLIIYAEDNQGATASQTILIQIADVNEPPTFTGSLAQGDQVSE
IYILEDTAPGTVIYRAAANDPEDAVLESNKQYFISPEGSGFTINSIGTISTAAVFDFESG
SRSFSLIIKVVDSGGLFTTGNLKIFLINVNNKDPVLTCRREISELDEEIPIGKMIGCQAT
DEDNLGDLTFELDPQNDYFAVDKEHGTVVTATRLDMERTGFGSVQSFSIKACDCNRRCAA
ILVTAYIHGINDNSPFCDRYLIRHTLREEIAKDTVVAKLLCHDLDEPPDTTPYAPSSGPV
GSGQLFEQVPNAENVIQVAKELDYEDPEIIAAGHTYEIMILVFDDLHPSHAVTMTIIVKV
APANDFSPVFKAAHYSFSVPETSGAFYKVGRVIAIDEDHPPNCVTYKIANGDTQVIQRFW
IHPLSGMIELTTQPDYESVKQYNLTVEAVDCDRFHSHTAMTMVTVDIENENDEAPVCTPS
LYKTVIFDNVALGTNVNGFALNCHDRDSQDFEIRFEMVSGNKNHNFGFDPTRGSNTPKLI
VKNPFNFESQAEVQRWYHLVVHIIDDNLKYGKSTKPRTGTAVIDIYVRRANMPPPPTTGS
EQRKGLTIVYTAINMYKSKGWYIPFIFTLMAIFFAGLISWVCFLLWKYGNIMECCQKTTN
NDLKPTLSQKQ
Download sequence
Identical sequences ENSMMUP00000039562 9544.ENSMMUP00000039562 ENSMMUP00000039562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]