SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039569 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039569
Domain Number 1 Region: 104-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000308
Family EGF-type module 0.034
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039569
Domain Number - Region: 52-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000109
Family Laminin-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039569   Gene: ENSMMUG00000008197   Transcript: ENSMMUT00000046536
Sequence length 143
Comment pep:known chromosome:MMUL_1:1:110305543:110392963:1 gene:ENSMMUG00000008197 transcript:ENSMMUT00000046536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPSISSIGNPPKFNRIWPNISSLEVSNPKQVAPKLALSTVSSVQVANHKRECYCNPLGSI
HDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTCHNNVRCLC
PAAYTGILCEKLRCEEAGSCGSD
Download sequence
Identical sequences ENSMMUP00000039569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]