SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039570 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039570
Domain Number 1 Region: 20-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 2 Region: 128-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000605
Family EGF-type module 0.034
Further Details:      
 
Domain Number 3 Region: 76-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family Laminin-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039570   Gene: ENSMMUG00000008197   Transcript: ENSMMUT00000046537
Sequence length 167
Comment pep:known chromosome:MMUL_1:1:110305543:110392963:1 gene:ENSMMUG00000008197 transcript:ENSMMUT00000046537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIPKGTANTCIPSISSIGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYF
RNASAQLDDENVCIECYCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQP
NVCDNELLHCQNGGTCHNNVRCLCPAAYTGILCEKLRCEEAGSCGSD
Download sequence
Identical sequences Q5IEC8
ENSMMUP00000039570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]