SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039572 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039572
Domain Number 1 Region: 297-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000111
Family Laminin-type module 0.052
Further Details:      
 
Domain Number 2 Region: 364-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000203
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039572
Domain Number - Region: 420-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000275
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 472-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 121-177
Classification Level Classification E-value
Superfamily Sialidases 0.0353
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039572   Gene: ENSMMUG00000008197   Transcript: ENSMMUT00000046539
Sequence length 539
Comment pep:known chromosome:MMUL_1:1:110042718:110394037:1 gene:ENSMMUG00000008197 transcript:ENSMMUT00000046539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKY
LKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCDFMVSG
LTYCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC
YCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTC
HNNVRCLCPAAYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF
Download sequence
Identical sequences 9544.ENSMMUP00000039572 ENSMMUP00000039572 ENSMMUP00000039570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]