SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039574 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039574
Domain Number 1 Region: 297-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family Laminin-type module 0.057
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039574
Domain Number - Region: 365-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000115
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 121-177
Classification Level Classification E-value
Superfamily Sialidases 0.0255
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039574   Gene: ENSMMUG00000008197   Transcript: ENSMMUT00000046541
Sequence length 438
Comment pep:known chromosome:MMUL_1:1:110042718:110394263:1 gene:ENSMMUG00000008197 transcript:ENSMMUT00000046541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKY
LKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISS
IGTNVCDNELLHCQNGGTCHNNVRCLCPAAYTGILCEKLRCEEAGSCGSDSGQGAPPHGS
PALLLLTTLLGTASPLVF
Download sequence
Identical sequences A0A2I2ZWL1 A0A2K5K874 A0A2K5KVX7 A0A2K5TR45 A0A2K5Z4U5 A0A2K6N736 F7H0F1 K7CZ65
ENSP00000359091 ENSMMUP00000039574 NP_055732.2.87134 NP_055732.2.92137 XP_003822279.1.60992 XP_005542610.1.63531 XP_006710519.1.92137 XP_007975969.1.81039 XP_008974024.1.60992 XP_010360146.1.97406 XP_011824270.1.47321 XP_011920776.1.92194 XP_011920777.1.92194 XP_015001712.1.72884 XP_016856174.1.92137 XP_018894383.1.27298 XP_018894442.1.27298 gi|54312078|ref|NP_055732.2| NYSGRC-54312078 ENSP00000359091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]