SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039642 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039642
Domain Number 1 Region: 379-637
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-65
Family Nuclear receptor ligand-binding domain 0.000000000769
Further Details:      
 
Domain Number 2 Region: 307-384
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-27
Family Nuclear receptor 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039642   Gene: ENSMMUG00000022922   Transcript: ENSMMUT00000046606
Sequence length 639
Comment pep:known_by_projection chromosome:MMUL_1:11:49169741:49189637:1 gene:ENSMMUG00000022922 transcript:ENSMMUT00000046606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLHHGQRPGPAPPRQPGAFSWALTADRIMWLAKACWSIQSEMPCIQAQYGTPAPSPGPRD
HLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCS
SASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAP
SPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPS
PSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDAPVTSTKTRSGA
PGGTEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRC
QFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPST
AKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLL
ESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLVVD
VPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKL
PELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
Download sequence
Identical sequences ENSMMUP00000030190 9544.ENSMMUP00000039642 ENSMMUP00000039642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]