SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039765 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039765
Domain Number 1 Region: 894-1063
Classification Level Classification E-value
Superfamily Fibronectin type III 5.11e-22
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 2 Region: 1707-1796
Classification Level Classification E-value
Superfamily Fibronectin type III 1.88e-19
Family Fibronectin type III 0.0000185
Further Details:      
 
Domain Number 3 Region: 624-784
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-17
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 1260-1344
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000225
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 5 Region: 801-891
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000623
Family Fibronectin type III 0.000003
Further Details:      
 
Domain Number 6 Region: 1620-1707
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000919
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 7 Region: 1078-1162
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000166
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 8 Region: 1169-1253
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000424
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 9 Region: 1348-1435
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000107
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 10 Region: 1439-1525
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000305
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 11 Region: 1529-1616
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000056
Family Fibronectin type III 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039765
Domain Number - Region: 412-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00011
Family Integrin beta EGF-like domains 0.056
Further Details:      
 
Domain Number - Region: 505-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000593
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 474-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00103
Family EGF-type module 0.093
Further Details:      
 
Domain Number - Region: 536-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00161
Family EGF-type module 0.08
Further Details:      
 
Domain Number - Region: 598-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00296
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 287-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00406
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 194-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00464
Family EGF-type module 0.088
Further Details:      
 
Domain Number - Region: 258-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00503
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 319-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 381-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00902
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 348-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00967
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 443-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0129
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 225-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 567-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0219
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039765   Gene: ENSMMUG00000003356   Transcript: ENSMMUT00000046737
Sequence length 1796
Comment pep:known_by_projection chromosome:MMUL_1:15:20995365:21045189:1 gene:ENSMMUG00000003356 transcript:ENSMMUT00000046737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAMTRLSAVVLLALLALLTEGGVLKKVIRHKRQSGVNITLPEENQPVVFNHVYNTKLPV
GSQCSVDLESPSGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCAAGAGCCLQSAIGRVDTRPFCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCNLRGQCIDGQCICDEGFTGEDCSQLACPGDCNDQGKCVNGVCICFE
GYAGADCSREICPVPCSEEHGTCVDGLCVCHEGFAGDDCNKPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKLTCPHACHGQGRCEEGQ
CVCDEGFAGVDCSEKRCPADCHNRGRCVDGQCECDDGFTGADCGELKCPSGCSGHGRCVN
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVQGKCVCEQGFKGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDRQCPRDCSNRGRCVDGQCVCEDGFTGPDCAELSCPNDCHGRG
RCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCMDGQCICHEGFTGLDCGQRSCPSDCSN
LGQCVSGRCICNEGYAGEDCSEVSPPKDLIVTEVTEETVNLAWDNEMRVTEYLVVYTPTH
EGGLEMQFRVPGDQTSTIIRELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQMEVKDVTDTTALITWFKPLAEIDGIELTYGIK
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHTEVDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKEDKESNPATINAATELDTPKDLRVSETAETSLTLFWKTPLAKFDRYRLNYS
LPTGQWVGVQLPRNTTSYVLRGLEPGQEYNVLLTAEKGRHKSKPARVKASTEQAPELENL
TVTEVGWDGLRLNWTAADQAYEHFVIQVQEANKVEAAQNLTVPGNLRAVDIPGLKAATPY
TVSIYGVIQGYRTPVLSAEASTGETPNLGEVMVAEVGWDALKLNWTVPEGAYEYFFIQVQ
EADTVEAAQNHTVPGGLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLTEEVPDMG
NLTVTEVSWDALRLNWTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSVEIPGLRAGT
PYTITLHGEVRGHSTRPLALEVITEELPQLGDLAVSEVGWDGLRLNWTAADQAYEHFVIQ
VQEVNKVEAAQNLTVPGSLRAVDIPGLKAATPYTVSIYGVIRGYRTPVLSAEASTAKEEI
GNLNVSNITPESFSLSWTATDGIFETFTIEIIDSNRLLEIVEYNISGAERTAHISGLPPS
TDFIVYLSGLAPSFRTKPISATATTEALPLLENLTISDINPYGFTVSWMASENAFDSFLV
TVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKPLRAEIVTEAEP
EVDNLLVSDATPDGFRLSWTADEGIFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGLR
EATEYEIELYGISKGRRSQPVSAIATTAMGSPKEVIFSDITENSATVSWRAPTAQVESFR
ITYVPITGGTPSMVTVDGTKTQTRLVKLVPGVEYLVNIIAMKGFEESEPVSGSFTT
Download sequence
Identical sequences ENSMMUP00000039765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]