SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039770 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039770
Domain Number 1 Region: 1608-1831
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.75e-80
Family Fibrinogen C-terminal domain-like 0.00000198
Further Details:      
 
Domain Number 2 Region: 894-1063
Classification Level Classification E-value
Superfamily Fibronectin type III 5.16e-22
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 3 Region: 1438-1602
Classification Level Classification E-value
Superfamily Fibronectin type III 4.06e-21
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 4 Region: 1345-1434
Classification Level Classification E-value
Superfamily Fibronectin type III 1.29e-19
Family Fibronectin type III 0.0000185
Further Details:      
 
Domain Number 5 Region: 714-878
Classification Level Classification E-value
Superfamily Fibronectin type III 4.13e-17
Family Fibronectin type III 0.00000922
Further Details:      
 
Domain Number 6 Region: 624-710
Classification Level Classification E-value
Superfamily Fibronectin type III 6.69e-16
Family Fibronectin type III 0.00097
Further Details:      
 
Domain Number 7 Region: 1258-1345
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000935
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 8 Region: 1079-1163
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000465
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 9 Region: 1167-1254
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000577
Family Fibronectin type III 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039770
Domain Number - Region: 412-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00011
Family Integrin beta EGF-like domains 0.056
Further Details:      
 
Domain Number - Region: 505-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000612
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 474-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00103
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 536-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00161
Family EGF-type module 0.08
Further Details:      
 
Domain Number - Region: 598-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00303
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 287-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00412
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 194-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00477
Family EGF-type module 0.088
Further Details:      
 
Domain Number - Region: 258-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00515
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 319-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00902
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 348-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00967
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 381-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00967
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 443-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0129
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 225-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0148
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 567-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0226
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039770   Gene: ENSMMUG00000003356   Transcript: ENSMMUT00000046742
Sequence length 1838
Comment pep:known_by_projection chromosome:MMUL_1:15:20968511:21066253:1 gene:ENSMMUG00000003356 transcript:ENSMMUT00000046742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAMTRLSAVVLLALLALLTEGGVLKKVIRHKRQSGVNITLPEENQPVVFNHVYNTKLPV
GSQCSVDLESPSGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCAAGAGCCLQSAIGRVDTRPFCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCNLRGQCIDGQCICDEGFTGEDCSQLACPGDCNDQGKCVNGVCICFE
GYAGADCSREICPVPCSEEHGTCVDGLCVCHEGFAGDDCNKPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKLTCPHACHGQGRCEEGQ
CVCDEGFAGVDCSEKRCPADCHNRGRCVDGQCECDDGFTGADCGELKCPSGCSGHGRCVN
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVQGKCVCEQGFKGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDRQCPRDCSNRGRCVDGQCVCEDGFTGPDCAELSCPNDCHGRG
RCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCMDGQCICHEGFTGLDCGQRSCPSDCSN
LGQCVSGRCICNEGYAGEDCSEVSPPKDLIVTEVTEETVNLAWDNEMRVTEYLVVYTPTH
EGGLEMQFRVPGDQTSTIIRELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQMEVKDVTDTTALITWFKPLAEIDGIELTYGIK
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHTEVDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKEDKESNPATINAATELDTPKDLRVSETAETSLTLFWKTPLAKFDRYRLNYS
LPTGQWVGVQLPRNTTSYVLRGLEPGQEYNVLLTAEKGRHKSKPARVKASTGDQRTEIGN
LNVSNITPESFSLSWTATDGIFETFTIEIIDSNRLLEIVEYNISGAERTAHISGLPPSTD
FIVYLSGLAPSFRTKPISATATTEALPLLENLTISDINPYGFTVSWMASENAFDSFLVTV
VDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKPLRAEIVTEAEPEV
DNLLVSDATPDGFRLSWTADEGIFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGLREA
TEYEIELYGISKGRRSQPVSAIATTAMGSPKEVIFSDITENSATVSWRAPTAQVESFRIT
YVPITGGTPSMVTVDGTKTQTRLVKLVPGVEYLVNIIAMKGFEESEPVSGSFTTALDGPS
GLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRMVSGNTVEYALTDLEPATEY
TLRIFAEKGPQKSSTVTAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLVYES
VDGTVKEVIVGPDTTSYSLVDLSPSSHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKD
CSQAMLNGDTTSGLYTIYLNGDKAQALEVFCDMTSDGGGWIVFLRRKNGHENFYQNWKAY
AAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKV
EGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNH
SQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Download sequence
Identical sequences 9544.ENSMMUP00000039770 ENSMMUP00000039770 ENSMMUP00000004472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]