SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039777 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039777
Domain Number 1 Region: 1065-1113,1144-1185
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000361
Family Fibronectin type III 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039777
Domain Number - Region: 653-700
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0381
Family Merozoite surface protein 1 (MSP-1) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039777   Gene: ENSMMUG00000013105   Transcript: ENSMMUT00000046749
Sequence length 1338
Comment pep:known_by_projection chromosome:MMUL_1:15:18671819:19658023:1 gene:ENSMMUG00000013105 transcript:ENSMMUT00000046749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGARLSPGPGSGLRGRPRLRFHPGPPPLPPLLLLFLLLLPPPPLLAGATAAASREPD
SPCRLKTVTVSTLPALRESDIGWSGARAGAGSGTGAGAAAAASPGSPGSAGTAAESRLLL
FVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENGTLYFHVSMSSSG
QLAQATAPTLQEPSEIVEEQMHILHISVMGGLIALLLLLLVFTVALYAQRRWQKRRRIPQ
KSASTEATHEIHYIPSVLLGPQARESFRSSRLQTHNSVIGVPIRETPILDDYDCEEEEEP
PRRANHVSREDEFGSQVTHTLDSLGRPGEEKVDFEKKAAAEVTQETVESLMQKFKESFRA
NTPIEIGQLQPALRSTSAGKRKRRSKSRGGISFGRAKGTSGSEADDETQLTFYTEQYRSR
RRSKGLLKSPVNKTALTLIAVSSCILAMVCGSQMSCPLTVKVTLHVPEHFIADGSSFVVS
EGSYLDISDWLNPAKLSLYYQINATSPWVRDLCGQRTTDACEQLCDPETGECSCYEGYAP
DPVHRHLCVRSDWGQSEGPWPYTTLERGYDLVTGEQAPEKILRSTFSLGQGLWLPVSKSF
VVPPVELSINPLASCKTDVLVTEDPADVREEAMLSTYFETINDLLSSFGPVRDCSRNNGG
CTRNFKCVSDRQVDSSGCVCPEELKPMKDGSGCYDHSKGIDCSDGFNGGCEQLCLQQTLP
LPYDATSSTIFMFCGCVEEYKLAPDGKSCLMLSDVCEGPKCLKPDSKFNDTLFGEMLHGY
NNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLTG
DIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLSAGFTNVLKILTKESSREELLSFIQHYG
SHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTELGSKKELKSMPFITYLSGLLTA
QMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDNG
TKEAFKSALMSSYWCSGKGDVIDDWCRCDLSAFDASGLPNCSPLPQPVLRLSPTVEPSST
VVSLEWVDVQPAIGTKVSDYILQHKKVDEYTDTDLYTGEFLSFADDLLSGLGTSCVAAGR
SHGEIPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLRTACPLVDDNKAEEI
ADKIYNLYNGYTSGKEQQMAYNTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGPR
KAHLILRRLERVSSHCSSLLRSAYIQSRVETVPYLFCRSEEVRPAGMVWYSILKDTKITC
EEKMVSMARNTYGESKGR
Download sequence
Identical sequences F7HU42
9544.ENSMMUP00000039777 ENSMMUP00000039777 ENSMMUP00000017211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]