SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039778 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039778
Domain Number 1 Region: 1044-1092,1123-1164
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000343
Family Fibronectin type III 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039778
Domain Number - Region: 632-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0372
Family Merozoite surface protein 1 (MSP-1) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039778   Gene: ENSMMUG00000013105   Transcript: ENSMMUT00000046750
Sequence length 1317
Comment pep:known_by_projection chromosome:MMUL_1:15:18671727:19658637:1 gene:ENSMMUG00000013105 transcript:ENSMMUT00000046750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FASASAVSAAASSFSFATTAATRSTAAPPAMAAAGARLSPGPGSGLRGRPRLRFHPGPPP
LPPLLLLFLLLLPPPPLLAGATAAASREPDSPCRLKTVTVSTLPALRESDIGWSGARAGA
GSGTGAGAAAAASPGSPGSAGTAAESRLLLFVRNELPGRIAVQDDLDNTELPFFTLEMSG
TAADISLVHWRQQWLENGTLYFHVSMSSSGQLAQATAPTLQEPSEIVEEQMHILHISVMG
GLIALLLLLLVFTVALYAQRRWQKRRRIPQKSASTEATHEIHYIPSVLLGPQARESFRSS
RLQTHNSVIGVPIRETPILDDYDCEEEEEPPRRANHVSREDEFGSQVTHTLDSLGRPGEE
KVDFEKKGGISFGRAKGTSGSEADDETQLTFYTEQYRSRRRSKGLLKSPVNKTALTLIAV
SSCILAMVCGSQMSCPLTVKVTLHVPEHFIADGSSFVVSEGSYLDISDWLNPAKLSLYYQ
INATSPWVRDLCGQRTTDACEQLCDPETGECSCYEGYAPDPVHRHLCVRSDWGQSEGPWP
YTTLERGYDLVTGEQAPEKILRSTFSLGQGLWLPVSKSFVVPPVELSINPLASCKTDVLV
TEDPADVREEAMLSTYFETINDLLSSFGPVRDCSRNNGGCTRNFKCVSDRQVDSSGCVCP
EELKPMKDGSGCYDHSKGIDCSDGFNGGCEQLCLQQTLPLPYDATSSTIFMFCGCVEEYK
LAPDGKSCLMLSDVCEGPKCLKPDSKFNDTLFGEMLHGYNNRTQHVNQGQVFQMTFRENN
FIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLTGDIRYDEAMGYPMVQQWRVRSN
LYRVKLSTITLSAGFTNVLKILTKESSREELLSFIQHYGSHYIAEALYGSELTCIIHFPS
KKVQQQLWLQYQKETTELGSKKELKSMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGR
CPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDNGTKEAFKSALMSSYWCSGKGDV
IDDWCRCDLSAFDASGLPNCSPLPQPVLRLSPTVEPSSTVVSLEWVDVQPAIGTKVSDYI
LQHKKVDEYTDTDLYTGEFLSFADDLLSGLGTSCVAAGRSHGEIPEVSIYSVIFKCLEPD
GLYKFTLYAVDTRGRHSELSTVTLRTACPLVDDNKAEEIADKIYNLYNGYTSGKEQQMAY
NTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGPRKAHLILRRLERVSSHCSSLLR
SAYIQSRVETVPYLFCRSEEVRPAGMVWYSILKDTKITCEEKMVSMARNTYGESKGR
Download sequence
Identical sequences ENSMMUP00000039778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]