SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039868 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039868
Domain Number 1 Region: 411-824
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.19e-109
Family Phosphofructokinase 0.00000789
Further Details:      
 
Domain Number 2 Region: 86-410
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.72e-106
Family Phosphofructokinase 0.000000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039868   Gene: ENSMMUG00000002045   Transcript: ENSMMUT00000046839
Sequence length 851
Comment pep:known chromosome:MMUL_1:11:45182009:45225692:1 gene:ENSMMUG00000002045 transcript:ENSMMUT00000046839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKDEFHLKFFMCVIQSRQLVRTPQRTAGEASTSSMLIPKPPTKTDTLKSLDTLDDPDTV
RSIPVFKTEWIMTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVF
FVHEGYQGLVDGGDNIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRG
ITNLCVIGGDGSLTGADTFRSEWSDLLGDLQKAGKITDEEATKSSYLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDRNGKPITSEDIKNLVVKRLGY
DTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLM
ECVQVTKDVTKAMEEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVG
APAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGT
KRTLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATV
SNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAG
ADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGK
GIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGC
VLGMRKRALLFQPVTELQGQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEH
ITRKRSGEGAV
Download sequence
Identical sequences A0A096N5N7 A0A2K5L904 A0A2K5XIR5 A0A2K6CRU3 G7N6T5 G7PHQ1
ENSMMUP00000039868 9544.ENSMMUP00000039868 ENSMMUP00000002741 XP_001096244.1.72884 XP_005570749.2.63531 XP_011758610.1.29376 XP_011758612.1.29376 XP_011758613.1.29376 XP_011758614.1.29376 XP_011758615.1.29376 XP_011843045.1.47321 XP_015007032.1.72884 XP_015007034.1.72884 XP_015007035.1.72884 XP_015007036.1.72884 XP_015286331.1.63531 XP_015286332.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]