SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039869 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039869
Domain Number 1 Region: 61-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039869
Domain Number - Region: 19-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00375
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039869   Gene: ENSMMUG00000023345   Transcript: ENSMMUT00000046840
Sequence length 690
Comment pep:known chromosome:MMUL_1:1:81712315:81830748:-1 gene:ENSMMUG00000023345 transcript:ENSMMUT00000046840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLPLLVVFSTLLNCSYTQNCTKTPCLPNAKCEIRNGIEACYCNMGFSGNGVTICEDDN
ECGNLTQSCGENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGTICIENVNANCHLDNV
CIAANINKTLTKIRPIKEPVALLREVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTI
SAKDTLSNSTLTELVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKLMHTVERATLRLSQSF
QKTTQFDTNSTDIALKVFFIDSSKMKHIHPHMNVDGDYINIFPKRKAAYISNGNVAVAFL
YYKSIGPLLSSSDNFLLKPQNYDNSEEEERVISSVISVSMSSNPPTLYELEKITFTLSHR
KITDRYKSLCAFWNYSPDTMNGTWSSEGCELTYSNETHTSCRCNHLTHFAILMSSGPSIG
IKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLVG
INTNTNKLFCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKNFYIFGYLS
PAVVVGFSAALGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNLLAFGVIIYKVFRHT
AGLKPEVSCFENIRSCARGALALLFLLGTTWIFGVLHVVHASVVTAYLFTVSNAFQGMFI
FLFLCVLSRKIQEEYYRLFKNVPCCFGCLR
Download sequence
Identical sequences ENSMMUP00000039869 ENSMMUP00000039869 9544.ENSMMUP00000039869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]