SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039887 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039887
Domain Number 1 Region: 137-406
Classification Level Classification E-value
Superfamily EndoU-like 1.44e-94
Family Eukaryotic EndoU ribonuclease 0.00000701
Further Details:      
 
Domain Number 2 Region: 21-63
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000196
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 88-128
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000353
Family Somatomedin B domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039887   Gene: ENSMMUG00000018399   Transcript: ENSMMUT00000046858
Sequence length 411
Comment pep:known chromosome:MMUL_1:11:44778329:44793125:-1 gene:ENSMMUG00000018399 transcript:ENSMMUT00000046858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRACIPLVLAVLCSLAWAGKMESCASRCNEKFNRDAACQCDRRCLRHGNCCEDYEHLCTE
DHKESEPLPQPEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQEFGNCCKDF
ESLCSDHEGFSHSSDAITKEEIQSISEKIYRADTNKAQKEDIILNSQNCISLSETRDQRD
RCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAV
MKELYSFLHHQNRYGSEQEFINDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGF
HNWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFA
LYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKHIATAYIVSSA
Download sequence
Identical sequences ENSMMUP00000024195 9544.ENSMMUP00000039887 ENSMMUP00000039887 XP_001097705.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]