SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000039922 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000039922
Domain Number 1 Region: 29-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.06e-42
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 2 Region: 477-588
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000275
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 3 Region: 431-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000883
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 267-331
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000115
Family VWC domain 0.016
Further Details:      
 
Domain Number 5 Region: 687-759
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000555
Family VWC domain 0.01
Further Details:      
 
Domain Number 6 Region: 594-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000249
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000039922
Domain Number - Region: 332-396
Classification Level Classification E-value
Superfamily FnI-like domain 0.000418
Family VWC domain 0.091
Further Details:      
 
Domain Number - Region: 397-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00303
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000039922   Gene: ENSMMUG00000017279   Transcript: ENSMMUT00000046890
Sequence length 815
Comment pep:known chromosome:MMUL_1:11:41475617:41850646:-1 gene:ENSMMUG00000017279 transcript:ENSMMUT00000046890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGLSASLFKAWLLISVWGLGVDPSLQIDVLSELELGESTTGVRQVPGLHNGTKAFLFQ
DTPRSIKASTATAEQFFQKLRNKHEFTILVTLKQTHLNSGVILSVHHLDHRYLELESSGH
RNEVRLHYRSGSHRPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPST
DLPLGTTLWLGQRNNAHGYFKGIMQDVQLLVMPQGFIAQCPDLNRTCPTCNDFHGLVQKI
MELQDILAKTSAKLSRAEQRMNRLDQCYCERTCTMKGTTYREFESWTDGCKNCTCLNGTI
QCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERSTVYSSSGVCVLYEC
KDQTMKLVESSGCPALDCPESQQITLSHSCCKVCKGYDFCSERHNCMENSVCRNLNDRAV
CSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCT
EHDECITNQHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIAANVC
ACPQGFTGPSCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESCE
DIDECGTGRHSCANDTICFNLDGGYDCRCPHGKNCTGDCIHDGKVKHNGQIWVLENDRCS
VCSCQNGFVMCRRMVCDCENPTVDLFCCPECDPRLSSQCLHQNGETLYNSGDTWVQNCQQ
CRCLQGEVDCWPLPCPDVECEFSILPENECCPRCVTDPCQADTIRNDITKTCLDEMNVVR
FTGSSWIKHGTECTLCQCKNGHICCSVDPQCLQEL
Download sequence
Identical sequences A0A2K5X0S8 A0A2K6C8S1 F7HTR6
ENSMMUP00000039922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]