SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040056 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040056
Domain Number 1 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family EGF-type module 0.059
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040056
Domain Number - Region: 24-65,104-166
Classification Level Classification E-value
Superfamily Sialidases 0.000128
Family Sialidases (neuraminidases) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040056   Gene: ENSMMUG00000006923   Transcript: ENSMMUT00000047025
Sequence length 423
Comment pep:known chromosome:MMUL_1:15:6437055:6504290:-1 gene:ENSMMUG00000006923 transcript:ENSMMUT00000047025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLE
ANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSAR
RARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMRE
GSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAGSFGSNLANPSPG
RSPSAPRASKKGLANVKEPAGSRPQISEMLLGCTVSLHQGSVGPHIPPTLSLPDPEGPWL
GSQ
Download sequence
Identical sequences ENSMMUP00000040056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]