SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040114 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040114
Domain Number 1 Region: 12-118,314-393
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.39e-31
Family FAD/NAD-linked reductases, N-terminal and central domains 0.014
Further Details:      
 
Domain Number 2 Region: 146-179,257-356
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000000000358
Family Siroheme synthase N-terminal domain-like 0.042
Further Details:      
 
Domain Number 3 Region: 124-221
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000237
Family FAD/NAD-linked reductases, N-terminal and central domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040114   Gene: ENSMMUG00000010854   Transcript: ENSMMUT00000047088
Sequence length 501
Comment pep:known_by_projection chromosome:MMUL_1:11:21798956:21833969:1 gene:ENSMMUG00000010854 transcript:ENSMMUT00000047088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAARPPATAGKFVVVGGGIAGVTCAEQLATQFPSEDILLITASPVIKAVTNFKQISKIL
EEFDVEEQSSTMLEKRFPNIKVIESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKPKL
ICEGNPYVLGIRDTDSAQEFQKQLTKAKRIMIIGNGGIALELVYEIEGCEVIWAIKDKAI
GNTFFDAGAAEFLTSKLIAEKPEAKIAQKRTRYTTEGRKKEARSKSKADNVGSALGPDWH
EGLNLKGTKEFSHKIHLETMCEVKKIYLQDEFRILKKKSFTFPRDPKSVTTDTGNMWPVY
VELTNEKIYGCDFIVSATGVTPNVEPFLHGNSFNLGEDGGLKVDDHMHTSLPDVYAAGDI
CTASWQLSPVWQQMRLWTQARQMGWYAAKCMAAASLGDSTDMDFSFELFAHVTKFFNYKV
VLLGKYNAQGLGSDHELMLRCTKGQEYIKVVMQNGRMMGAVLIGETDLEETFENLILNQM
NLSSYGEDLLDPNIDIEDYFD
Download sequence
Identical sequences ENSMMUP00000014227 ENSMMUP00000040114 9544.ENSMMUP00000040114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]