SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040166 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040166
Domain Number 1 Region: 159-222
Classification Level Classification E-value
Superfamily Homeodomain-like 7.27e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 62-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000428
Family LIM domain 0.012
Further Details:      
 
Domain Number 3 Region: 31-61
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000274
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040166   Gene: ENSMMUG00000004882   Transcript: ENSMMUT00000047145
Sequence length 402
Comment pep:known chromosome:MMUL_1:15:2101348:2107392:1 gene:ENSMMUG00000004882 transcript:ENSMMUT00000047145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARGELGPARESAGGDLLLALLARRADLRREIPLCAGCDQHILDRFILKALDRHWHSKC
LKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHC
FACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSA
YNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSR
GGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPATGLYGSLGEPTPALGRPSGALGNFAL
EHGGLAGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSGAPDGP
PPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF
Download sequence
Identical sequences F6YE82
ENSMMUP00000006492 ENSMMUP00000040166 9544.ENSMMUP00000040166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]