SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040185 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000040185
Domain Number - Region: 245-281
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0173
Family 7-Fe ferredoxin 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040185   Gene: ENSMMUG00000032125   Transcript: ENSMMUT00000047165
Sequence length 349
Comment pep:known_by_projection chromosome:MMUL_1:11:13311565:13322002:-1 gene:ENSMMUG00000032125 transcript:ENSMMUT00000047165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKDCIESTGDYFLPCDSEGPWGIVLESLAILGIVVTILLLLAFLFLMRKIQDCSQWNVL
PTQLLFLLSVLGLFGLAFAFIIQLNQQTAPVRYFLFGVLFALCFSCLLAHASNLVKLVRG
RVSFSWTTILCIAIGCSLLQVIIAIEYVTLIMTRGMMFVHMTPYQLNVDFVVLLVYVLFL
MXXXXXXXXXXXXKATFCGPCENWKQHGRLIFITVLFSIIIWVVWISMLLRGNPQFQRQP
QWDDPVVCIALVTNAWVFLLLYIVPELCILYRSCRQECPSQGHACPVTAYQRSFQVENQE
LSRARDSDGAEEDVALTSFGTPIQPQTVDPTQECFIPRAKLSPQQDAGV
Download sequence
Identical sequences ENSMMUP00000040185 ENSMMUP00000040185 9544.ENSMMUP00000040185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]