SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040188 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040188
Domain Number 1 Region: 1849-1990
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.62e-33
Family Ankyrin repeat 0.000000915
Further Details:      
 
Domain Number 2 Region: 871-1002
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000121
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 1071-1213
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000137
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 4 Region: 350-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000232
Family EGF-type module 0.00028
Further Details:      
 
Domain Number 5 Region: 391-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000921
Family EGF-type module 0.00045
Further Details:      
 
Domain Number 6 Region: 467-509
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000215
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 7 Region: 429-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000274
Family EGF-type module 0.00068
Further Details:      
 
Domain Number 8 Region: 757-888
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000487
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 9 Region: 692-729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000679
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 10 Region: 568-696
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 11 Region: 542-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000365
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 12 Region: 80-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 13 Region: 196-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000464
Family EGF-type module 0.016
Further Details:      
 
Domain Number 14 Region: 1047-1082
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000383
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 502-544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000447
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 16 Region: 116-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 17 Region: 234-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000184
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 18 Region: 1209-1253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000572
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 43-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000607
Family EGF-type module 0.026
Further Details:      
 
Domain Number 20 Region: 271-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000965
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 21 Region: 1390-1423
Classification Level Classification E-value
Superfamily Notch domain 0.000000102
Family Notch domain 0.0052
Further Details:      
 
Domain Number 22 Region: 158-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 23 Region: 1291-1329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000992
Family EGF-type module 0.02
Further Details:      
 
Domain Number 24 Region: 1349-1381
Classification Level Classification E-value
Superfamily Notch domain 0.0000017
Family Notch domain 0.00017
Further Details:      
 
Domain Number 25 Region: 1015-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family EGF-type module 0.022
Further Details:      
 
Domain Number 26 Region: 313-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000516
Family EGF-type module 0.057
Further Details:      
 
Domain Number 27 Region: 1-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000529
Family EGF-type module 0.015
Further Details:      
 
Domain Number 28 Region: 1246-1286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000656
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040188
Domain Number - Region: 1430-1461
Classification Level Classification E-value
Superfamily Notch domain 0.000115
Family Notch domain 0.0056
Further Details:      
 
Domain Number - Region: 733-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0222
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040188   Gene: ENSMMUG00000017022   Transcript: ENSMMUT00000047167
Sequence length 2259
Comment pep:known chromosome:MMUL_1:15:1771618:1800257:1 gene:ENSMMUG00000017022 transcript:ENSMMUT00000047167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCLSTPCKNAGTCHVVDRGGMADYACSCPLGFSGPLCLTPLDNACLTNPCRNGGTCDLLT
LTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNE
CGQNPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTH
ECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQL
MPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCEC
PHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGAN
PCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPG
YEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGA
KCLDGPNTYTCVCTEGYTGMHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHCE
TNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKIDG
YECACEPGYTGSMCNINIDECAGNPCHNGGTCQDGINGFTCRCPEGYHDPTCLSEVNECN
SNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCRE
GFSGATCEVVLAPCAPSPCRNGGECRESEDYESFSCVCPTGWQGQTCEVDINECVVSPCR
HGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQG
TFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCV
DGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNL
VHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVAQLCQHG
GLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVN
CSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCF
NNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGH
TGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLN
GGTCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAK
FNGLLCHILDYSFGGGAGRDIPPPQIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDC
SLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCKPLYDQYCKDH
FSDGHCDQGCSAECEWDGLDCAEHVPERLAAGTLVVVLMPPEQLRNSSFHFLRELSRVLH
TNVVFKRDAHGQQMIFPYYLPGGGGGGRRRRELDPMDVRGSIVYLEIDNRQCVQASSQCF
QSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVAAAAFVLLFFVGCG
VLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEW
GDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDADCMD
VNVRGPGGFWVPGLGQVRVVGLAQGPGPTAAAPRGPTPPSTLAAGVACGKINVGERKEHR
REPRMVCCVPLSAAFFAQMWKFLGALQESGGHGRRHQCTSAQHPPEPLPVAQILIRNRAT
DLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVV
LLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMH
HDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRKPSSKGL
ACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLPSPFQQS
PSVPLNHLPDDELPGPAQHPAGHPASPGADPAGAAAKLTDAAAEPAATKHPAAAKPAAAT
PLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSSPVDNTPSHQLQ
VPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTS
Download sequence
Identical sequences ENSMMUP00000040188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]