SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040189 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040189
Domain Number 1 Region: 1597-1736
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.19e-33
Family Ankyrin repeat 0.000000915
Further Details:      
 
Domain Number 2 Region: 859-993
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000377
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 376-488
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000157
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 635-676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000196
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 5 Region: 736-876
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000549
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 94-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000303
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 7 Region: 480-523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000075
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 8 Region: 559-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000157
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 9 Region: 672-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 10 Region: 210-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family EGF-type module 0.016
Further Details:      
 
Domain Number 11 Region: 130-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000857
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 12 Region: 248-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 13 Region: 521-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 14 Region: 593-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000025
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 57-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000447
Family EGF-type module 0.026
Further Details:      
 
Domain Number 16 Region: 285-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000607
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 17 Region: 989-1033
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000655
Family EGF-type module 0.014
Further Details:      
 
Domain Number 18 Region: 1147-1180
Classification Level Classification E-value
Superfamily Notch domain 0.0000000759
Family Notch domain 0.0052
Further Details:      
 
Domain Number 19 Region: 172-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000163
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 20 Region: 13-53
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family EGF-type module 0.014
Further Details:      
 
Domain Number 21 Region: 1029-1066
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000196
Family EGF-type module 0.016
Further Details:      
 
Domain Number 22 Region: 327-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000219
Family EGF-type module 0.057
Further Details:      
 
Domain Number 23 Region: 1106-1138
Classification Level Classification E-value
Superfamily Notch domain 0.00000353
Family Notch domain 0.00018
Further Details:      
 
Domain Number 24 Region: 1071-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000382
Family EGF-type module 0.019
Further Details:      
 
Domain Number 25 Region: 1187-1218
Classification Level Classification E-value
Superfamily Notch domain 0.000085
Family Notch domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040189   Gene: ENSMMUG00000017022   Transcript: ENSMMUT00000047168
Sequence length 1737
Comment pep:known chromosome:MMUL_1:15:1771576:1799006:1 gene:ENSMMUG00000017022 transcript:ENSMMUT00000047168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRGGMADYACSCPLGFSGPLCLTPLDNACL
TNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCP
PSFHGPTCRQDVNECGQNPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPC
QNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEW
TGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHG
ATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGP
ACSQDVDECSLALPGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQND
ATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGYTGMH
CEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRD
NAYLCFCLKGTTGSMCNINIDECAGNPCHNGGTCQDGINGFTCRCPEGYHDPTCLSEVNE
CNSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTC
REGFSGATCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCF
NGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTG
PNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVA
QLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVA
GYHGVNCSEEIDECLSHPCQNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDAR
GTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAG
FEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYN
QGTCEPTSESPFYRCLCPAKFNGLLCCELPECQEDAGNKVCSLQCNNHACGWDGGDCSLN
FNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCKPLYDQYCKDHFSD
GHCDQGCSAECEWDGLDCAEHVPEGGGHAVVVVLMPPEQLRNSSFHFLRELSRVLHTNVV
FKRDAHGQQMIFPYYGREEELRKHPIKRAAEGWAAPEALLGQVFFFFKCISIVYLEIDNR
QCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVAAAA
FVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKTAAPSQSV
DFLTACFWRHLFPGWILGAWSWAGQGSQAEAGLAGGLGDLLSEAAPAHPPQDRLHQAPGG
PRAGSDGHSPGDTSSSCRNKCRNQASAAWHLAPAFCTRQGGGAIPPARGQGQAALQGLPT
ALRAQLDTVARRFCDGCRAVSPASRVPAVTPVGAEPLPVAQILIRNRATDLDARMHDGTT
PLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQ
NNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLD
Download sequence
Identical sequences ENSMMUP00000040189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]