SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040191 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040191
Domain Number 1 Region: 613-868
Classification Level Classification E-value
Superfamily YWTD domain 1.07e-56
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 3-262
Classification Level Classification E-value
Superfamily YWTD domain 9.68e-54
Family YWTD domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 312-558
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 4 Region: 916-1175
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-39
Family YWTD domain 0.0000396
Further Details:      
 
Domain Number 5 Region: 870-917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000733
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1306-1344
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000125
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 1227-1267
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 568-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 9 Region: 1268-1304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 1185-1238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000315
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000040191
Domain Number - Region: 265-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000389
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040191   Gene: ENSMMUG00000023317   Transcript: ENSMMUT00000047170
Sequence length 1594
Comment pep:known chromosome:MMUL_1:11:12475663:12601940:-1 gene:ENSMMUG00000023317 transcript:ENSMMUT00000047170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFGHGLIYWSDVSEEAIKRT
EFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELD
QPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYW
ADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGL
REIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPGVKLLEN
GKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDD
EVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKI
LISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDY
DEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVH
KRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFE
LISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWT
DISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHR
QVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTID
YAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERAN
KTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCGCPAH
YALNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQL
YWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVIN
VTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFS
GLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYW
IDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICL
VKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDH
SDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCI
GKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLC
PRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPP
YDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRP
YSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLS
AEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences ENSMMUP00000040191 ENSMMUP00000040191 9544.ENSMMUP00000040191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]