SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000040197 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000040197
Domain Number 1 Region: 137-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000921
Family EGF-type module 0.006
Further Details:      
 
Domain Number 2 Region: 107-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000381
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000040197   Gene: ENSMMUG00000026981   Transcript: ENSMMUT00000036682
Sequence length 234
Comment pep:known chromosome:MMUL_1:15:1614365:1621953:-1 gene:ENSMMUG00000026981 transcript:ENSMMUT00000036682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGSQEMLLVWLLVLAAGGTEHAYRPGRRVCAVGAHGDPVSESFVQRVYQPFLTTCDGHR
ACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCIQP
GRCRCPAGWQGDTCQSDVDECSAGGAGCPQRCVNTAGSYWCQCWEGHSLSADGTHCVSKG
GPPRVAPNLTVQHSGRRHAPAGDGTLLLLVRAVTLQTRTVSNNALSTAPHRKRR
Download sequence
Identical sequences ENSMMUP00000040197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]